PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000280486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 351aa    MW: 40276.2 Da    PI: 5.2848
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000280486genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM133.61.3e-41181442128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                    p+GfrFhPt +elv++yLk k ++k++++ ++i+e+d+++++PwdL +++ +++  wyfFs++d ky +++r+n +t  g Wk tgk+++++++ +
  MDP0000280486  18 PVGFRFHPTPDELVDHYLKLKKQDKDFKC-DHIAEFDVCNFDPWDLAARIPSDDMVWYFFSRKDYKYINSNRSNXTTPGGHWKITGKERAIKARrS 112
                    89***************************.89**************99999999**************************************9856 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++l+g k+tL+fy+  +pk++ktdWvmhe+ l
  MDP0000280486 113 KALIGKKRTLTFYRRCQPKPKKTDWVMHEFYL 144
                    667**************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-4814167IPR003441NAC domain
PROSITE profilePS5100545.19917168IPR003441NAC domain
PfamPF023653.1E-2218143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGTLGSNRKR RVGGASDPVG FRFHPTPDEL VDHYLKLKKQ DKDFKCDHIA EFDVCNFDPW  60
DLAARIPSDD MVWYFFSRKD YKYINSNRSN XTTPGGHWKI TGKERAIKAR RSKALIGKKR  120
TLTFYRRCQP KPKKTDWVMH EFYLXDSEAI SNPKLHQKDF VLCRMKKNSD MEDTSIGEVE  180
LGSYSVSNVE DXAAAVVTPE VRMRTVSSLN IFLXDVDLLK LNASLFHALH SQDYSSSTFL  240
SSGYIELGDI PHGNDNIDDC NAMQSPFGYN NYXYPDKNDI STCDEGEPPG LTMSDFENEV  300
LDHMSQEVCP PREENLELFF YPPQPEDYTX EPLMNXTVGX VLHDNEFRSP I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-311816816170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376046.11e-148PREDICTED: NAC domain-containing protein 78-like isoform X2
TrEMBLM5XFX41e-76M5XFX4_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14450518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.17e-39NAC 014